PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.T016900.1
Common NamePOPTR_0004s10800g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family CO-like
Protein Properties Length: 370aa    MW: 40786.5 Da    PI: 6.2445
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.T016900.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box22.42.6e-071560241
         zf-B_box  2 eerkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvp 41
                     ++r+C+++   + + +C+ ++ +lC+ C    H        H++v+
  Potri.T016900.1 15 RARVCDTCRAAPCTVYCRADSAYLCAGCDARVHAAnrvasrHERVS 60
                     6899*****************************6577888898887 PP

2zf-B_box27.66.1e-0959104342
         zf-B_box   3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvpl 42 
                        +C+ +e+ ++ l C+ +   lC  C   +H+       H++vp+
  Potri.T016900.1  59 VSVCEACERAPAALLCKADAASLCTACDADIHSAnplarrHQRVPI 104
                      579*****************************66899999**9997 PP

3CCT69.11.2e-23300343144
              CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                      Rea++lRY+eK+ktRkFeK+irY+sRKa+Ae+RpR+KGrF+k++
  Potri.T016900.1 300 REARVLRYREKKKTRKFEKTIRYASRKAYAETRPRIKGRFAKRK 343
                      9*****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011911.4621461IPR000315B-box-type zinc finger
SMARTSM003361.4E-101461IPR000315B-box-type zinc finger
PfamPF006431.1E-51560IPR000315B-box-type zinc finger
CDDcd000212.56E-71761No hitNo description
PROSITE profilePS5011911.5957104IPR000315B-box-type zinc finger
PfamPF006434.6E-759104IPR000315B-box-type zinc finger
CDDcd000213.48E-861104No hitNo description
SMARTSM003363.8E-1062104IPR000315B-box-type zinc finger
PROSITE profilePS5101716.648300342IPR010402CCT domain
PfamPF062031.7E-17300342IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009416Biological Processresponse to light stimulus
GO:0009909Biological Processregulation of flower development
GO:0005634Cellular Componentnucleus
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 370 aa     Download sequence    Send to blast
MLKQESSGGG GGDNRARVCD TCRAAPCTVY CRADSAYLCA GCDARVHAAN RVASRHERVS  60
VCEACERAPA ALLCKADAAS LCTACDADIH SANPLARRHQ RVPILPISGC LHGSPVGPAA  120
GETEDRFTTQ EGEETISEEE EDEAASWLLL NPVKNSKNQN NNGFLFGGEV DEYLDLVEYN  180
SCTENQCSDQ YNQQHYCVPP KSYGGDRAVP IQYGEGKDHQ QQRQYHNFQL GLEYEPSKAA  240
CSYNGSISQS VSMSSMDVGV VPESTMSEIS ISQHRPPKGT MELFSSTAIQ MPSQLSPMDR  300
EARVLRYREK KKTRKFEKTI RYASRKAYAE TRPRIKGRFA KRKDVEVEDD QMFSSTLMAE  360
TGYGIVPSF*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pth.128280.0bud| leaf
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY5151510.0AY515151.1 Populus deltoides CONSTANS-like protein CO2 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002305307.10.0CONSTANS-like protein CO2
SwissprotQ965021e-142COL2_ARATH; Zinc finger protein CONSTANS-LIKE 2
TrEMBLB9H3V00.0B9H3V0_POPTR; CONSTANS-like protein CO2
STRINGPOPTR_0004s10800.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF38273352
Representative plantOGRP6911767
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G02380.11e-102CONSTANS-like 2